(data stored in ACNUC30630 zone)

EMBL: AP009256.SECE

AP009256.SECE        Location/Qualifiers
FT   CDS             320936..321163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BAD_0245"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="COG family: preprotein translocase subunit SecE"
FT                   /note="Orthologue of BL1287"
FT                   /note="PFAM_ID: SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39026"
FT                   /db_xref="GOA:A0ZZZ3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZZ3"
FT                   /protein_id="BAF39026.1"
FT                   /translation="MAKAKNSEKAIKPNIFMRIGLFIKQIIDELRKVVTPTSKELFFWS
FT                   LAVFIFVLLLMALVTGMDYGLGKLTLWIFG"
     MAKAKNSEKA IKPNIFMRIG LFIKQIIDEL RKVVTPTSKE LFFWSLAVFI FVLLLMALVT        60
     GMDYGLGKLT LWIFG                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page