(data stored in ACNUC30630 zone)

EMBL: AP009256.TGT

AP009256.TGT         Location/Qualifiers
FT   CDS             complement(68587..70047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="BAD_0056"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /note="COG family: queuine_archaeosinetRNA-
FT                   ribosyltransferase"
FT                   /note="Guanine insertion enzyme Tgt"
FT                   /note="Orthologue of BL0556"
FT                   /note="PFAM_ID: TGT"
FT                   /note="tRNA-guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38837"
FT                   /db_xref="GOA:A0ZZF4"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZF4"
FT                   /protein_id="BAF38837.1"
FT                   /translation="MAPPRQSALSHTVESMTSLNEPQTGAVAHETSAANAAAGATHDAA
FT                   GNTTSAASTENLIEHPRGAEPGKPGRRDAFYFEQKTRLPDAADGKGRGGARYGRTGIIH
FT                   TPHGDIHTPAFVPVATQAAMKAVLPETMKDLGAQCLLSNAFHLYERPGEQVLDEAGGLA
FT                   KFMNWNGPTFTDSGGFQVLSLGAGFKKTLAMDVTGMKSDDVIAEGKERLAFVDEDGVTF
FT                   KSPLNGSLHRFSAEISMGIQHKIGADIMFAFDELTTLMNTRGYQERSVERTYRWAQRCV
FT                   AEHRRLTEERLGKPYQALYGVVQGANYEDLRRHAAEQIASLDFDGVGIGGAIEKRIIGD
FT                   TCAWICDAMPESRPRHVLGIAAVDDIFACVENGGDTFDCVAPARCGRNGAIFTRHGRYN
FT                   IKRAQFKHDFGPLEEGCDCYTCTHYSRAYVDHALRAREFNGFTLATIHNEHFFVKLLDD
FT                   IRASIDGGYFEKFRDETLAHFYENGSKG"
     MAPPRQSALS HTVESMTSLN EPQTGAVAHE TSAANAAAGA THDAAGNTTS AASTENLIEH        60
     PRGAEPGKPG RRDAFYFEQK TRLPDAADGK GRGGARYGRT GIIHTPHGDI HTPAFVPVAT       120
     QAAMKAVLPE TMKDLGAQCL LSNAFHLYER PGEQVLDEAG GLAKFMNWNG PTFTDSGGFQ       180
     VLSLGAGFKK TLAMDVTGMK SDDVIAEGKE RLAFVDEDGV TFKSPLNGSL HRFSAEISMG       240
     IQHKIGADIM FAFDELTTLM NTRGYQERSV ERTYRWAQRC VAEHRRLTEE RLGKPYQALY       300
     GVVQGANYED LRRHAAEQIA SLDFDGVGIG GAIEKRIIGD TCAWICDAMP ESRPRHVLGI       360
     AAVDDIFACV ENGGDTFDCV APARCGRNGA IFTRHGRYNI KRAQFKHDFG PLEEGCDCYT       420
     CTHYSRAYVD HALRAREFNG FTLATIHNEH FFVKLLDDIR ASIDGGYFEK FRDETLAHFY       480
     ENGSKG                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page