(data stored in ACNUC30630 zone)

EMBL: AP009256.THIG

AP009256.THIG        Location/Qualifiers
FT   CDS             complement(124790..125704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BAD_0089"
FT                   /product="thiazole biosynthesis protein thiG"
FT                   /note="Functions in thiamine (vitamine B1) biosynthesis"
FT                   /note="In Bacillus subtilis this enzyme catalyzes the
FT                   formationof thiazole from dehydroxyglycine
FT                   and1-deoxy-D-xylulose-5-phosphate and ThiS-thiocarboxylate"
FT                   /note="Orthologue of BL1055"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAF38870"
FT                   /db_xref="GOA:A0ZZI7"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZZI7"
FT                   /protein_id="BAF38870.1"
FT                   /translation="MSTENTITTAAADVAAAPNATLDELVGTTTNTAILPEPDAHAYDE
FT                   IATGDADPLILGGHKFTSRFILGSGRYDLNLIKATIENAGTQIVTMALRRCRTTENNLL
FT                   DYIPKGITMLPNTSGARNAEEAVRIARLAREVCQTDFVKVEIEHEAKYLLPDNEETIKA
FT                   TKQLAKEGFVVMPYMFPDPIAAKRLEDAGAACVMPLGAMIGSNKGLRARDFIEVIIKNS
FT                   NVPVIIDAGIGRPSQAAEAMEMGADAVMAYTAIASAGNIPLMARAFKKAIEAGREAYLS
FT                   GLGKVTEDHAVPSSPTNEADYIG"
     MSTENTITTA AADVAAAPNA TLDELVGTTT NTAILPEPDA HAYDEIATGD ADPLILGGHK        60
     FTSRFILGSG RYDLNLIKAT IENAGTQIVT MALRRCRTTE NNLLDYIPKG ITMLPNTSGA       120
     RNAEEAVRIA RLAREVCQTD FVKVEIEHEA KYLLPDNEET IKATKQLAKE GFVVMPYMFP       180
     DPIAAKRLED AGAACVMPLG AMIGSNKGLR ARDFIEVIIK NSNVPVIIDA GIGRPSQAAE       240
     AMEMGADAVM AYTAIASAGN IPLMARAFKK AIEAGREAYL SGLGKVTEDH AVPSSPTNEA       300
     DYIG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page