(data stored in ACNUC30630 zone)

EMBL: AP009256.VRRB

AP009256.VRRB        Location/Qualifiers
FT   CDS             complement(504063..504767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vrrB"
FT                   /locus_tag="BAD_0400"
FT                   /product="hypervariable Bacillus group-specific protein"
FT                   /note="Orthologue of BCZK4489"
FT                   /db_xref="EnsemblGenomes-Gn:BAD_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF39181"
FT                   /db_xref="UniProtKB/TrEMBL:A1A0E8"
FT                   /protein_id="BAF39181.1"
FT                   /translation="MVATHGFGFDEELRAAERARDVVPDRVGSVMDHRDVHAALVLMRI
FT                   EQGEHADHHRAGDHHQQIHARAGRDAGRDGPEQVQQVHRILHGGTVTHDGQRAHHTKRD
FT                   HDVRADGQCDHAGEHAHAHQRHREAARIHDARVEPPVYAVDDDAHQQRHQQGQRHFGHV
FT                   VLAEGVQHRFLDHVVYAHGFVFSFAIVRLLRFLRLPMFSAARFRPSVFGLPRYVRPVRS
FT                   SHTLGTFQPSCQ"
     MVATHGFGFD EELRAAERAR DVVPDRVGSV MDHRDVHAAL VLMRIEQGEH ADHHRAGDHH        60
     QQIHARAGRD AGRDGPEQVQ QVHRILHGGT VTHDGQRAHH TKRDHDVRAD GQCDHAGEHA       120
     HAHQRHREAA RIHDARVEPP VYAVDDDAHQ QRHQQGQRHF GHVVLAEGVQ HRFLDHVVYA       180
     HGFVFSFAIV RLLRFLRLPM FSAARFRPSV FGLPRYVRPV RSSHTLGTFQ PSCQ             234
//

If you have problems or comments...

PBIL Back to PBIL home page