(data stored in ACNUC7421 zone)

EMBL: AP009493.PE100

AP009493.PE100       Location/Qualifiers
FT   CDS             99586..100347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_100t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_100t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16929"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA6"
FT                   /protein_id="BAG16929.1"
FT                   /translation="MRPHDYVRRPFVSRPSGVLLRHGPGRHAMSSASGPNSCPTPSDRT
FT                   TPGRQWEIFLVAANLSGPDLEVISVSQLAAEVQLRNDTVGAVAGFLQAVGLLRGARGNY
FT                   ALTSAGWAIAEMHKQDETQARLLLQAQFLEHWPAASTLECLHDAPVDQKTLGRRLHKDL
FT                   PGKSRRGLYLIEWLVRALIVQRDSAMRISPSAALLASGRRSATASGPEPQRMAEQGTLM
FT                   GMTRDELRSLPPRKYIAVLDQLAALVALDPA"
     MRPHDYVRRP FVSRPSGVLL RHGPGRHAMS SASGPNSCPT PSDRTTPGRQ WEIFLVAANL        60
     SGPDLEVISV SQLAAEVQLR NDTVGAVAGF LQAVGLLRGA RGNYALTSAG WAIAEMHKQD       120
     ETQARLLLQA QFLEHWPAAS TLECLHDAPV DQKTLGRRLH KDLPGKSRRG LYLIEWLVRA       180
     LIVQRDSAMR ISPSAALLAS GRRSATASGP EPQRMAEQGT LMGMTRDELR SLPPRKYIAV       240
     LDQLAALVAL DPA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page