(data stored in ACNUC7421 zone)

EMBL: AP009493.PE101

AP009493.PE101       Location/Qualifiers
FT   CDS             100493..100642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_101t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_101t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16930"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA7"
FT                   /protein_id="BAG16930.1"
FT                   /translation="MFFQAVRVLAPASSPMPCSVLPRSVVSACMQALVGLWALPGLMWS
FT                   GRAA"
     MFFQAVRVLA PASSPMPCSV LPRSVVSACM QALVGLWALP GLMWSGRAA                    49
//

If you have problems or comments...

PBIL Back to PBIL home page