(data stored in ACNUC7421 zone)

EMBL: AP009493.PE102

AP009493.PE102       Location/Qualifiers
FT   CDS             100727..101578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_102t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_102t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16931"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA8"
FT                   /protein_id="BAG16931.1"
FT                   /translation="MPLMPLFRGRFFDPVIPFSKKQEMLPSAAGSLPRCRFRRVDPAVV
FT                   EARFVDGAGQEHQVPWLHAAAESPLEECVPVQRFPVLKGRRVAPGWWWAATSGRHVHYG
FT                   FGAMRTQVMLLDRDPQVTALACRPVELMWRGRGGKVVSHAPHLMARLADGSGVLIDCAG
FT                   ARGAGRRLIQRAVHVEAAAEAAGWHYRVVGAPTPAVEANVRWLAGYRHPRCASSGLSSV
FT                   SECFRMPRPLVEGVRLLGDPIAVWPAVFHALWRGVLSTPLHRPLHERALTVSAYPGAGA
FT                   HL"
     MPLMPLFRGR FFDPVIPFSK KQEMLPSAAG SLPRCRFRRV DPAVVEARFV DGAGQEHQVP        60
     WLHAAAESPL EECVPVQRFP VLKGRRVAPG WWWAATSGRH VHYGFGAMRT QVMLLDRDPQ       120
     VTALACRPVE LMWRGRGGKV VSHAPHLMAR LADGSGVLID CAGARGAGRR LIQRAVHVEA       180
     AAEAAGWHYR VVGAPTPAVE ANVRWLAGYR HPRCASSGLS SVSECFRMPR PLVEGVRLLG       240
     DPIAVWPAVF HALWRGVLST PLHRPLHERA LTVSAYPGAG AHL                         283
//

If you have problems or comments...

PBIL Back to PBIL home page