(data stored in ACNUC7421 zone)

EMBL: AP009493.PE104

AP009493.PE104       Location/Qualifiers
FT   CDS             103824..104732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_104t"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_104t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16933"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB0"
FT                   /protein_id="BAG16933.1"
FT                   /translation="MGDPVWTKRSQLDYHSEFVTLRTASMEQCLRQLRLLLALNHCQEG
FT                   TARRGLIVSGPPGAGKSTTLMEMARSFELSYRRRHPDRADTLPVAFVGIPPSYSPKALV
FT                   RALARFLCLPVHDRMTENTITDAVCAVLCERGTRIVFIDDVHLLNTRTRPGADTSDQLK
FT                   SLAERIPATFVLAGVDVETSPLLTGPRGAQLAARFKLLRTLPLLNGTKQQKLEWRYLLN
FT                   EMEAALRLSHHRTGTLERHADYIHLRTGGVMASLSQLVREAAICAVLDGSQAITKKSLS
FT                   GIVLDVQATKGSRPSRGSGAS"
     MGDPVWTKRS QLDYHSEFVT LRTASMEQCL RQLRLLLALN HCQEGTARRG LIVSGPPGAG        60
     KSTTLMEMAR SFELSYRRRH PDRADTLPVA FVGIPPSYSP KALVRALARF LCLPVHDRMT       120
     ENTITDAVCA VLCERGTRIV FIDDVHLLNT RTRPGADTSD QLKSLAERIP ATFVLAGVDV       180
     ETSPLLTGPR GAQLAARFKL LRTLPLLNGT KQQKLEWRYL LNEMEAALRL SHHRTGTLER       240
     HADYIHLRTG GVMASLSQLV REAAICAVLD GSQAITKKSL SGIVLDVQAT KGSRPSRGSG       300
     AS                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page