(data stored in ACNUC7421 zone)

EMBL: AP009493.PE105

AP009493.PE105       Location/Qualifiers
FT   CDS             104950..106029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_105t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_105t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16934"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB1"
FT                   /protein_id="BAG16934.1"
FT                   /translation="MPPVAGELTSSWSRRLALGYGMPVQDLVRGVISRPEGTRITGAAR
FT                   SGRELYLNGPARAAFARFSGIPLNELAARLPGFAFSHERLEEDAVARAAWWAPRKAWVA
FT                   ACPPCSGRSWSRHQPVLVYPEAAGHVCQRHHRWLLANCQQASAIDLRPLPEVLLAHRRH
FT                   AALVRSHPEARAVMKLAAAAVWSWQVQGWQQKAGWHSPTSLLASLTGCAPSAVAAHTLI
FT                   AYPDTVTVARLLADQSWQARLRETATASGTPAATQVLLEEVGRRTRRLWLGDWMAACSR
FT                   AGSRPGVGAGNVLEQWVARLSGADGAGHRAGEGLWAVPRPARRPVGYGERTSYLIESSS
FT                   REANEEAGRAFLTGGWEPT"
     MPPVAGELTS SWSRRLALGY GMPVQDLVRG VISRPEGTRI TGAARSGREL YLNGPARAAF        60
     ARFSGIPLNE LAARLPGFAF SHERLEEDAV ARAAWWAPRK AWVAACPPCS GRSWSRHQPV       120
     LVYPEAAGHV CQRHHRWLLA NCQQASAIDL RPLPEVLLAH RRHAALVRSH PEARAVMKLA       180
     AAAVWSWQVQ GWQQKAGWHS PTSLLASLTG CAPSAVAAHT LIAYPDTVTV ARLLADQSWQ       240
     ARLRETATAS GTPAATQVLL EEVGRRTRRL WLGDWMAACS RAGSRPGVGA GNVLEQWVAR       300
     LSGADGAGHR AGEGLWAVPR PARRPVGYGE RTSYLIESSS REANEEAGRA FLTGGWEPT        359
//

If you have problems or comments...

PBIL Back to PBIL home page