(data stored in ACNUC7421 zone)

EMBL: AP009493.PE106

AP009493.PE106       Location/Qualifiers
FT   CDS             106026..106295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_106t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_106t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16935"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB2"
FT                   /protein_id="BAG16935.1"
FT                   /translation="MISPLIEIGVMPASLLVQPARPPSPSVWRTHEVARARSPPPLITP
FT                   PFHSVSMLSIRFRRDIVSLHFLTIEPPVAVPVRADAVTTTGPSC"
     MISPLIEIGV MPASLLVQPA RPPSPSVWRT HEVARARSPP PLITPPFHSV SMLSIRFRRD        60
     IVSLHFLTIE PPVAVPVRAD AVTTTGPSC                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page