(data stored in ACNUC7421 zone)

EMBL: AP009493.PE108

AP009493.PE108       Location/Qualifiers
FT   CDS             107701..108693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_108t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_108t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16937"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB4"
FT                   /protein_id="BAG16937.1"
FT                   /translation="MSLTSNLATVHSPISRFLSLELPAVACLIGDLRSRLPLCPDTVSP
FT                   SPPGPFSYGTLGQAIDLRLRIAFGTPVGSALTSGVTLTAMDMTEARSPEAGRAVAEAGQ
FT                   ELLRLLEAQRPASPGAMLHEPADEDHLARMCFTAGWFEEVYRSALHAGSPLLQADLSRG
FT                   LDGLLNQVPGYVPGDITAMASLADRPEALQWVLRLPAEQRLCGPVFAGSGHVGGADADF
FT                   IASGHLIDCKATIHPKRIGRPQLYQLAGYLLLDYDDSFKVDQVSLYLARQGRLIGWSTE
FT                   EFLRLLGARRSLPELREACRRALSVPDEAPPSVMPRQLRGEQDTLFTDL"
     MSLTSNLATV HSPISRFLSL ELPAVACLIG DLRSRLPLCP DTVSPSPPGP FSYGTLGQAI        60
     DLRLRIAFGT PVGSALTSGV TLTAMDMTEA RSPEAGRAVA EAGQELLRLL EAQRPASPGA       120
     MLHEPADEDH LARMCFTAGW FEEVYRSALH AGSPLLQADL SRGLDGLLNQ VPGYVPGDIT       180
     AMASLADRPE ALQWVLRLPA EQRLCGPVFA GSGHVGGADA DFIASGHLID CKATIHPKRI       240
     GRPQLYQLAG YLLLDYDDSF KVDQVSLYLA RQGRLIGWST EEFLRLLGAR RSLPELREAC       300
     RRALSVPDEA PPSVMPRQLR GEQDTLFTDL                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page