(data stored in ACNUC7421 zone)

EMBL: AP009493.PE110

AP009493.PE110       Location/Qualifiers
FT   CDS             109697..112009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_110t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_110t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16939"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB6"
FT                   /protein_id="BAG16939.1"
FT                   /translation="MTESFFMTFAEPGEDLPLPFSGAPSGAENHESGMRREVVTGRGDG
FT                   AVPGPAAYPGLPLGGIDAGGGFDPGARQALALARAVADLRQEALFNFGEMTGVKLTAVL
FT                   EQMLEHSELPDAYLDTVRAVFAPPEGYAAALRQLMEPGAVVVLLREPGAGRSFAAQALL
FT                   ADLRQRTGARVGPLSFGGGSRFPVRRLPLEENVAYLLELPADEEKFEVAEDFGAVLGRI
FT                   QYTLGKRNSRLVVLTAPEQWARICRGAPPGVVPLLGQPDPAKIAVAWLRAEAPELDASK
FT                   WVQDDRIAGLLRNQAPGDVLQVVSLIINATRGRRRSTSTSATTDAFTQQVLDVVAARNN
FT                   WRSSLLQWHSKEGRTSFQRNFLLVAAMFRNAPVAHVYAQTAELSEQLSKREAVALEGQG
FT                   SPGVIEMVDSIDAELAADDTVQFSKPGWDDAVLNYFWVDRPMARTEFLAWMAKAPLART
FT                   TKFLETFTPEDRLLLANRVGAFAVRWAVRHGKANPLEDVVIAWRKDDALWAAAVDLISA
FT                   AALHPTMSRFVHAVLLRWSKNAGADRAALQKISVEVCAGEFGRRHTGKALRRLRHAAET
FT                   VHDDVQTSLYEAVRNLWADASARPTLFSSVVEWCSADPSRAEAGRRSFLALATLLSKED
FT                   RGLPVLLSTGEDQPDFPTADLISGWRTLLDSGSVADDSARAVGLWMDAAVEYPDQRPVV
FT                   FNVLRGAVDTAGRAGGSHPRHRLRDLLYLWQPVPAVDADPERVRLRHELVDLLDHDRSR
FT                   SVALYRPVRMGRGGPTP"
     MTESFFMTFA EPGEDLPLPF SGAPSGAENH ESGMRREVVT GRGDGAVPGP AAYPGLPLGG        60
     IDAGGGFDPG ARQALALARA VADLRQEALF NFGEMTGVKL TAVLEQMLEH SELPDAYLDT       120
     VRAVFAPPEG YAAALRQLME PGAVVVLLRE PGAGRSFAAQ ALLADLRQRT GARVGPLSFG       180
     GGSRFPVRRL PLEENVAYLL ELPADEEKFE VAEDFGAVLG RIQYTLGKRN SRLVVLTAPE       240
     QWARICRGAP PGVVPLLGQP DPAKIAVAWL RAEAPELDAS KWVQDDRIAG LLRNQAPGDV       300
     LQVVSLIINA TRGRRRSTST SATTDAFTQQ VLDVVAARNN WRSSLLQWHS KEGRTSFQRN       360
     FLLVAAMFRN APVAHVYAQT AELSEQLSKR EAVALEGQGS PGVIEMVDSI DAELAADDTV       420
     QFSKPGWDDA VLNYFWVDRP MARTEFLAWM AKAPLARTTK FLETFTPEDR LLLANRVGAF       480
     AVRWAVRHGK ANPLEDVVIA WRKDDALWAA AVDLISAAAL HPTMSRFVHA VLLRWSKNAG       540
     ADRAALQKIS VEVCAGEFGR RHTGKALRRL RHAAETVHDD VQTSLYEAVR NLWADASARP       600
     TLFSSVVEWC SADPSRAEAG RRSFLALATL LSKEDRGLPV LLSTGEDQPD FPTADLISGW       660
     RTLLDSGSVA DDSARAVGLW MDAAVEYPDQ RPVVFNVLRG AVDTAGRAGG SHPRHRLRDL       720
     LYLWQPVPAV DADPERVRLR HELVDLLDHD RSRSVALYRP VRMGRGGPTP                  770
//

If you have problems or comments...

PBIL Back to PBIL home page