(data stored in ACNUC7421 zone)

EMBL: AP009493.PE111

AP009493.PE111       Location/Qualifiers
FT   CDS             112006..112740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_111t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_111t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16940"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB7"
FT                   /protein_id="BAG16940.1"
FT                   /translation="MSWLRWGLRDQQPELFEDQVTSSQSGLDFTMAFRTEWRAPRSTPV
FT                   PRLPSGEASRTVRVLAEQVAARHTVLRPTAAEQEINRLLARSLPLRTDELEVSWACVSV
FT                   SVAVEVRTYAEQIAQARRELELDALAQRQVQARMRFMHEEILRTPASARIYLMLENSAR
FT                   LGVLPPGLDVDGVVQEIQRWNPQSRWVVVAQLVHTFIDRLSEPDADALLVTLRSLFHDF
FT                   GEPDLAAQVPAPATPPSQAPGS"
     MSWLRWGLRD QQPELFEDQV TSSQSGLDFT MAFRTEWRAP RSTPVPRLPS GEASRTVRVL        60
     AEQVAARHTV LRPTAAEQEI NRLLARSLPL RTDELEVSWA CVSVSVAVEV RTYAEQIAQA       120
     RRELELDALA QRQVQARMRF MHEEILRTPA SARIYLMLEN SARLGVLPPG LDVDGVVQEI       180
     QRWNPQSRWV VVAQLVHTFI DRLSEPDADA LLVTLRSLFH DFGEPDLAAQ VPAPATPPSQ       240
     APGS                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page