(data stored in ACNUC7421 zone)

EMBL: AP009493.PE112

AP009493.PE112       Location/Qualifiers
FT   CDS             112760..112978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_112t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_112t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16941"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB8"
FT                   /protein_id="BAG16941.1"
FT                   /translation="MKLPLLRAVLAPRTSWQAWRVVRASGGTVSFDAAWRSARVQLHPD
FT                   EAGYRAAGHDSPQPPTEDAADKPTTTA"
     MKLPLLRAVL APRTSWQAWR VVRASGGTVS FDAAWRSARV QLHPDEAGYR AAGHDSPQPP        60
     TEDAADKPTT TA                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page