(data stored in ACNUC7421 zone)

EMBL: AP009493.PE113

AP009493.PE113       Location/Qualifiers
FT   CDS             113076..116987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_113t"
FT                   /product="putative exodeoxyribonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_113t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16942"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNB9"
FT                   /protein_id="BAG16942.1"
FT                   /translation="MPVGACLLREHGRASAYAASRHPCGVLSVLVSKLSVITDERALLG
FT                   RRAMAYVQHLSVRVPWHDTGWAGTVCADPGANHACVMLGNIAKDRDVRREAAHAGAPWS
FT                   KLGQVLPPCVVERGGFMSSSDHAVRRTHPYGWFLKDLGPARLEVPAFSVHAIPYFWMNR
FT                   SNAEEVVLQERPVSGYNPEAEDRIAAMLDSRLPWVMHGENQQAIMKTFFRDVVPEQSLV
FT                   FFYLKHSPFENQPRRMLVGAACVSGKQPPPPWPGSADSAFPSHMWETTLRHSLRPGGTG
FT                   GILLPVQALAAAAARGMDVASALARAPEVGRNFSYATEHVSSDSTVASLMELRRAAQAA
FT                   TALGDPAIGIPEESLQWLDDQLHRAWKRRGPCPGLPAVLAQLGFRHPTFAAQTIISAAG
FT                   EKADPWPVLENILESETASAELSALATQTRRRIWAGTGPQERQALRVLSRFDLTPEAVS
FT                   GVLSGGTSVPVGHDELLANPYDLVTCTVDDGEPIAFETVDRGCFPDLQLTEHHPLPLTQ
FT                   PFDDANDRRRIDAAMTAVLLRAQEEGHTLLPVEQMAERLGQLTVAVPLATDETILRPLG
FT                   LAPEALLDSDSHDEPEVWSQLRRVDLASGKAAYKLASAALRRDFIRERLNQLRDGKPHC
FT                   VPADLAKTLDTALSGLVAAADSDLEARARVEKAAAFSEIFHRRVTIVNGPAGTGKTTLI
FT                   QALAKRSEVTRRGLLLLAPTGKARVQLEQKVGYQALTLAQFLRHSDRYDDVHGRYLTLP
FT                   DGRRISVGTVVVDEASMLTEDMLAALLDAVEITERLILVGDPRQLPPIGAGRPFVDLER
FT                   RRRPDHSNWPRVAPGWAELTVLHRQQGHTRDDLALAHWYSGDKRSDDAEEVWEKLRTRA
FT                   PMATLKAVHWNGRPAARVLDDVLREEFTVTDELSFTHSYGATTRTDAKGNEYPNYTHAS
FT                   GSCDRWQALSPTRGQTHGTVELNRYLKQTYRRRALADAQLIKSRRRVPQPLGPEQIVVG
FT                   DKVVNTRNQYLRAYRPSTGKTEDRSYVANGELGVVTGQLKSKKMTGAPWQTQVEFSSQP
FT                   DLRFAAQRGLDDDPGLELAWALTVHKSQGSEFGTVVLMLPAHVSGISRELLYTALTRQT
FT                   RKVIICHEGPLEDLRELAQPTASDTARRLTDLTRPPEPVVVHDRQGRRIGCFDANLIHI
FT                   THFGLPVSSKNEVIIADLLHRLARGRFEYEQPLTGRDGKTKFPDFTITTDDPDRPIYWE
FT                   HLGMLDSPRYRETWERKKDWYAAQGILPGDTGGPNGLLLITDDRNGVKEQEWEATFRKA
FT                   FGSTASIRPRSIGRRRGSP"
     MPVGACLLRE HGRASAYAAS RHPCGVLSVL VSKLSVITDE RALLGRRAMA YVQHLSVRVP        60
     WHDTGWAGTV CADPGANHAC VMLGNIAKDR DVRREAAHAG APWSKLGQVL PPCVVERGGF       120
     MSSSDHAVRR THPYGWFLKD LGPARLEVPA FSVHAIPYFW MNRSNAEEVV LQERPVSGYN       180
     PEAEDRIAAM LDSRLPWVMH GENQQAIMKT FFRDVVPEQS LVFFYLKHSP FENQPRRMLV       240
     GAACVSGKQP PPPWPGSADS AFPSHMWETT LRHSLRPGGT GGILLPVQAL AAAAARGMDV       300
     ASALARAPEV GRNFSYATEH VSSDSTVASL MELRRAAQAA TALGDPAIGI PEESLQWLDD       360
     QLHRAWKRRG PCPGLPAVLA QLGFRHPTFA AQTIISAAGE KADPWPVLEN ILESETASAE       420
     LSALATQTRR RIWAGTGPQE RQALRVLSRF DLTPEAVSGV LSGGTSVPVG HDELLANPYD       480
     LVTCTVDDGE PIAFETVDRG CFPDLQLTEH HPLPLTQPFD DANDRRRIDA AMTAVLLRAQ       540
     EEGHTLLPVE QMAERLGQLT VAVPLATDET ILRPLGLAPE ALLDSDSHDE PEVWSQLRRV       600
     DLASGKAAYK LASAALRRDF IRERLNQLRD GKPHCVPADL AKTLDTALSG LVAAADSDLE       660
     ARARVEKAAA FSEIFHRRVT IVNGPAGTGK TTLIQALAKR SEVTRRGLLL LAPTGKARVQ       720
     LEQKVGYQAL TLAQFLRHSD RYDDVHGRYL TLPDGRRISV GTVVVDEASM LTEDMLAALL       780
     DAVEITERLI LVGDPRQLPP IGAGRPFVDL ERRRRPDHSN WPRVAPGWAE LTVLHRQQGH       840
     TRDDLALAHW YSGDKRSDDA EEVWEKLRTR APMATLKAVH WNGRPAARVL DDVLREEFTV       900
     TDELSFTHSY GATTRTDAKG NEYPNYTHAS GSCDRWQALS PTRGQTHGTV ELNRYLKQTY       960
     RRRALADAQL IKSRRRVPQP LGPEQIVVGD KVVNTRNQYL RAYRPSTGKT EDRSYVANGE      1020
     LGVVTGQLKS KKMTGAPWQT QVEFSSQPDL RFAAQRGLDD DPGLELAWAL TVHKSQGSEF      1080
     GTVVLMLPAH VSGISRELLY TALTRQTRKV IICHEGPLED LRELAQPTAS DTARRLTDLT      1140
     RPPEPVVVHD RQGRRIGCFD ANLIHITHFG LPVSSKNEVI IADLLHRLAR GRFEYEQPLT      1200
     GRDGKTKFPD FTITTDDPDR PIYWEHLGML DSPRYRETWE RKKDWYAAQG ILPGDTGGPN      1260
     GLLLITDDRN GVKEQEWEAT FRKAFGSTAS IRPRSIGRRR GSP                        1303
//

If you have problems or comments...

PBIL Back to PBIL home page