(data stored in ACNUC7421 zone)

EMBL: AP009493.PE114

AP009493.PE114       Location/Qualifiers
FT   CDS             complement(117256..119205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_114t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_114t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16943"
FT                   /db_xref="InterPro:IPR022205"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC0"
FT                   /protein_id="BAG16943.1"
FT                   /translation="MQLLALALYHRDGRKPPRILRFRPGALNILTGESETGKSEVLTIV
FT                   DYCLGRRAPNLPDDLIDQTVGWYALLVTFADNSRMVLARPRPAGASTQHAYTRTGGAGL
FT                   DIPRSDELVSNSNVAALRSELSARLGIEDFHFQPPTGAARNAFDVSIAQAALLCFQSQN
FT                   EIADQTALFHRQTESGMVQALKDTLPYFLGAAGPEQALRRHRLGESQRAQRAAQRKLDD
FT                   ALRHQQAMDANGLALVRLAEAEGLLTEVPAAPDTTQVLDLLHQALAAAPETAAPLELRD
FT                   RRQELNDERRALREQLQEFDEALAAVDRWQQQGRAFTGELHLQLDRLKTLDLLGPERRH
FT                   DTSVCPMCTQPLEHPDPSAHDITELTGHLASELAKAQTLQPVREEHRRALQTGRTDVTE
FT                   RLRLNGAQLKELLASDERLRNLQEQNLRVAHIQGRVSEALTRTGTDSDIARLRQNLVLA
FT                   QDQAATLEQLVDEDDVAAETERRLADIAVGMTAWAKRLNLGGAADATEVAISLKLLNVV
FT                   LRRPSGRLPLTRIGSAKNHIGYHLVAHLALHTYLRRNNRPVPGFLMLDQPTQAFFPEKP
FT                   RDASTIQDADWATVTAYFQLLNDVVQLNQGAFQIIVCDHANLPEGWFQEAVIGNWRPDA
FT                   DGRRTALIPLDWLG"
     MQLLALALYH RDGRKPPRIL RFRPGALNIL TGESETGKSE VLTIVDYCLG RRAPNLPDDL        60
     IDQTVGWYAL LVTFADNSRM VLARPRPAGA STQHAYTRTG GAGLDIPRSD ELVSNSNVAA       120
     LRSELSARLG IEDFHFQPPT GAARNAFDVS IAQAALLCFQ SQNEIADQTA LFHRQTESGM       180
     VQALKDTLPY FLGAAGPEQA LRRHRLGESQ RAQRAAQRKL DDALRHQQAM DANGLALVRL       240
     AEAEGLLTEV PAAPDTTQVL DLLHQALAAA PETAAPLELR DRRQELNDER RALREQLQEF       300
     DEALAAVDRW QQQGRAFTGE LHLQLDRLKT LDLLGPERRH DTSVCPMCTQ PLEHPDPSAH       360
     DITELTGHLA SELAKAQTLQ PVREEHRRAL QTGRTDVTER LRLNGAQLKE LLASDERLRN       420
     LQEQNLRVAH IQGRVSEALT RTGTDSDIAR LRQNLVLAQD QAATLEQLVD EDDVAAETER       480
     RLADIAVGMT AWAKRLNLGG AADATEVAIS LKLLNVVLRR PSGRLPLTRI GSAKNHIGYH       540
     LVAHLALHTY LRRNNRPVPG FLMLDQPTQA FFPEKPRDAS TIQDADWATV TAYFQLLNDV       600
     VQLNQGAFQI IVCDHANLPE GWFQEAVIGN WRPDADGRRT ALIPLDWLG                   649
//

If you have problems or comments...

PBIL Back to PBIL home page