(data stored in ACNUC7421 zone)

EMBL: AP009493.PE115

AP009493.PE115       Location/Qualifiers
FT   CDS             complement(119237..119722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_115t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_115t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16944"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC1"
FT                   /protein_id="BAG16944.1"
FT                   /translation="MTTDSHRNVSEVQALFNPAFGAYLLASAVNTATKKAERPLPWPSA
FT                   FLILPLVLPADTRDSLPGKSTVTLTAWAHEHPRLQAAFAERAATLTNYTRTSLRTAMRH
FT                   QAIDVTPGGLVCPRTPKPASAAPGEEVADCARAAALVGRWLAVTDPTRAFTTLGVRP"
     MTTDSHRNVS EVQALFNPAF GAYLLASAVN TATKKAERPL PWPSAFLILP LVLPADTRDS        60
     LPGKSTVTLT AWAHEHPRLQ AAFAERAATL TNYTRTSLRT AMRHQAIDVT PGGLVCPRTP       120
     KPASAAPGEE VADCARAAAL VGRWLAVTDP TRAFTTLGVR P                           161
//

If you have problems or comments...

PBIL Back to PBIL home page