(data stored in ACNUC7421 zone)

EMBL: AP009493.PE116

AP009493.PE116       Location/Qualifiers
FT   CDS             complement(119719..121101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_116t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_116t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16945"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC2"
FT                   /protein_id="BAG16945.1"
FT                   /translation="MLRCGPGERNSASHQTEQPRAAFLVRPVAGVGLAPLRPARSVVGN
FT                   VARARSHSAAGQMTGYLYQGELALLELARRSWQDPTVEVRMELLDDIEFLDPDKTPREL
FT                   LQAKHREAAGPLSETGKDFWRSVASWIDALKKLSDPADAAMPILRLVSTQTAPPGTFFQ
FT                   YLSDGPDRDETKALERMEETADDADGPVTTAEDRELFMQLAPARRQQLVRAITVNDAAP
FT                   LMSDLDSSLAKELGITPSDHAQAALDEIKGWWYGMAVKLLERKNPQHMRASVSAQELMC
FT                   RRDEVTGRYIGKNLPITETLRHLTQAEIADYNDRLVVTQMRWIGLPDDEVAMHLRDYHY
FT                   ARAQRSEWLRTFKITPERLDEYEGELHYEWETAFRRRTRRIRDDMSEEQRQDIGQEILD
FT                   ATMDRVADTQLRPGSVTAPWIGTGSAHGLSDQADTAEPDRQLGWHPNYQDLCQSPDESQ
FT                   EQ"
     MLRCGPGERN SASHQTEQPR AAFLVRPVAG VGLAPLRPAR SVVGNVARAR SHSAAGQMTG        60
     YLYQGELALL ELARRSWQDP TVEVRMELLD DIEFLDPDKT PRELLQAKHR EAAGPLSETG       120
     KDFWRSVASW IDALKKLSDP ADAAMPILRL VSTQTAPPGT FFQYLSDGPD RDETKALERM       180
     EETADDADGP VTTAEDRELF MQLAPARRQQ LVRAITVNDA APLMSDLDSS LAKELGITPS       240
     DHAQAALDEI KGWWYGMAVK LLERKNPQHM RASVSAQELM CRRDEVTGRY IGKNLPITET       300
     LRHLTQAEIA DYNDRLVVTQ MRWIGLPDDE VAMHLRDYHY ARAQRSEWLR TFKITPERLD       360
     EYEGELHYEW ETAFRRRTRR IRDDMSEEQR QDIGQEILDA TMDRVADTQL RPGSVTAPWI       420
     GTGSAHGLSD QADTAEPDRQ LGWHPNYQDL CQSPDESQEQ                             460
//

If you have problems or comments...

PBIL Back to PBIL home page