(data stored in ACNUC7421 zone)

EMBL: AP009493.PE120

AP009493.PE120       Location/Qualifiers
FT   CDS             complement(123895..125793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_120t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_120t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16949"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC6"
FT                   /protein_id="BAG16949.1"
FT                   /translation="MAPTPDLVREIAAIRRMLADSEPAPVRSSYLADPSQGRPVHQGST
FT                   APALVPEWHQHPSGLLVPASSAQSPAPIDLMAVYLTAEEIFGFVPPSDYTERQLERIPL
FT                   EDVLRFCAWALTALAMPDASARDVEKTFVNTLMQGPLRDRVLNLLRDDRRRLLVPQAVM
FT                   LLARTAVHVSPDTVPQGAPKGDLTVALLCNSQSMGHHSESGPTVIADQPGPLGREIIAN
FT                   QHFNHTWSVSGVLARYARRWLELPMEHLSEPGAIDLSQAYEDCTGVRLDDLAAVAGYLW
FT                   ARTTQGHFVLEHAEYSALTLPAERLHRVLSLISNDLPGMREAVRQERPEHRTEWSFDPF
FT                   QRWPVIRLPQRRLLVLDPRHLVSRAFGWLPILDIRFPPPHHPRPSGHKTLATRAEQTLR
FT                   RISEVYVSEVLHRITEDASTVRRVYDDAQLKAAYTVKGQRIADAAVDYPGTWIVIEVTT
FT                   TQLRREAATAVPDESQIKDIDKLIEEVDQINATIDALRQDETALTGISPTHPRRFLPLL
FT                   VLPEGFPVNPVTLTVIRERARSRGLLQAPDTDPLEIADIEELEMIEGIQEDGGPSLLEI
FT                   LQSKNAGTLRNTGLREHIFYGLNLSPSKPARHAELFATALQPLFEALPRPEPEPPA"
     MAPTPDLVRE IAAIRRMLAD SEPAPVRSSY LADPSQGRPV HQGSTAPALV PEWHQHPSGL        60
     LVPASSAQSP APIDLMAVYL TAEEIFGFVP PSDYTERQLE RIPLEDVLRF CAWALTALAM       120
     PDASARDVEK TFVNTLMQGP LRDRVLNLLR DDRRRLLVPQ AVMLLARTAV HVSPDTVPQG       180
     APKGDLTVAL LCNSQSMGHH SESGPTVIAD QPGPLGREII ANQHFNHTWS VSGVLARYAR       240
     RWLELPMEHL SEPGAIDLSQ AYEDCTGVRL DDLAAVAGYL WARTTQGHFV LEHAEYSALT       300
     LPAERLHRVL SLISNDLPGM REAVRQERPE HRTEWSFDPF QRWPVIRLPQ RRLLVLDPRH       360
     LVSRAFGWLP ILDIRFPPPH HPRPSGHKTL ATRAEQTLRR ISEVYVSEVL HRITEDASTV       420
     RRVYDDAQLK AAYTVKGQRI ADAAVDYPGT WIVIEVTTTQ LRREAATAVP DESQIKDIDK       480
     LIEEVDQINA TIDALRQDET ALTGISPTHP RRFLPLLVLP EGFPVNPVTL TVIRERARSR       540
     GLLQAPDTDP LEIADIEELE MIEGIQEDGG PSLLEILQSK NAGTLRNTGL REHIFYGLNL       600
     SPSKPARHAE LFATALQPLF EALPRPEPEP PA                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page