(data stored in ACNUC7421 zone)

EMBL: AP009493.PE121

AP009493.PE121       Location/Qualifiers
FT   CDS             complement(126320..127660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_121t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_121t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16950"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC7"
FT                   /protein_id="BAG16950.1"
FT                   /translation="MLRVSKPVSHQWDGKEEADGRGSVSAASYDLGMAYESARDLPSYL
FT                   ELERQLKVVRFLGRSNRKLADAIRLQLREFGDTVDAFYDLFGGKHWIFHDRLPLEPVRA
FT                   IVANAGEDVDGAERKLIELYHDAESLPFMILPLRKLPAMRRRLTLVERARQDYFAGRYY
FT                   ATVQVLLSVMDGFVNEFESVRRGLHARAPEELQAWDSVVGHHRGLQHAHKTFTKGRTAT
FT                   LEEPVYELYRNGIVHGSILNYDNLTVATKAWNRLFAVADWAAARLKQQEHQSKEPVTLS
FT                   SVGRQLKELTSTALRQAEINRVNEKWNPGRHLPGSETFNSHPAHTHTRELLNCWMRRNY
FT                   GSLSDLLTYDLHTRHGKAVRSEVRRVYDPFVLSAFEILSIHHDMAAACTVTATLDHGSS
FT                   ATTEVELRWVREDAQSYPTPEPWPGNWRLVTWDPRCYLGRIAPSSSR"
     MLRVSKPVSH QWDGKEEADG RGSVSAASYD LGMAYESARD LPSYLELERQ LKVVRFLGRS        60
     NRKLADAIRL QLREFGDTVD AFYDLFGGKH WIFHDRLPLE PVRAIVANAG EDVDGAERKL       120
     IELYHDAESL PFMILPLRKL PAMRRRLTLV ERARQDYFAG RYYATVQVLL SVMDGFVNEF       180
     ESVRRGLHAR APEELQAWDS VVGHHRGLQH AHKTFTKGRT ATLEEPVYEL YRNGIVHGSI       240
     LNYDNLTVAT KAWNRLFAVA DWAAARLKQQ EHQSKEPVTL SSVGRQLKEL TSTALRQAEI       300
     NRVNEKWNPG RHLPGSETFN SHPAHTHTRE LLNCWMRRNY GSLSDLLTYD LHTRHGKAVR       360
     SEVRRVYDPF VLSAFEILSI HHDMAAACTV TATLDHGSSA TTEVELRWVR EDAQSYPTPE       420
     PWPGNWRLVT WDPRCYLGRI APSSSR                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page