(data stored in ACNUC7421 zone)

EMBL: AP009493.PE122

AP009493.PE122       Location/Qualifiers
FT   CDS             complement(127755..128036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_122t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_122t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16951"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC8"
FT                   /protein_id="BAG16951.1"
FT                   /translation="MAIQITAVRLTAGGTTHEHITHLWWTNQASGNSGNNTRAQLVDWI
FT                   DNQSGEAYTDAAGHRTKVVVVTPTRGEKYLRTHADGVWTNNLLALPRR"
     MAIQITAVRL TAGGTTHEHI THLWWTNQAS GNSGNNTRAQ LVDWIDNQSG EAYTDAAGHR        60
     TKVVVVTPTR GEKYLRTHAD GVWTNNLLAL PRR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page