(data stored in ACNUC7421 zone)

EMBL: AP009493.PE123

AP009493.PE123       Location/Qualifiers
FT   CDS             complement(128183..129208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_123t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_123t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16952"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNC9"
FT                   /protein_id="BAG16952.1"
FT                   /translation="MVNYVRAGAARTQAAAMITELEAARPGAAELLAQDALAKLRTWPE
FT                   LTVKDVPENETAQGCSVAGAYDYGPPPRLSVATSASHARRDFTALHELGHHLQKNSFDL
FT                   MEPFSREPDGGVLLEDAACDAFAAQILLPAHLVDQHLDAKGPTASAITLLWKTSNASRM
FT                   AVCVRAAQHLPAPGHVLLLDPDGHLAFAASNGLPPLPRGSFQGDIPVIDRALTGPGRAQ
FT                   GRTQVRYRDGILGRELHTDTAPMDGYTVAVLVTDSAPWRAFTPPTADTGPRSRDYICAN
FT                   CDENYRSFEPACPRCHVPHCPECGSCACPPRTPGRSCPGCFLKHPPAMFAPDSDRCLDC
FT                   S"
     MVNYVRAGAA RTQAAAMITE LEAARPGAAE LLAQDALAKL RTWPELTVKD VPENETAQGC        60
     SVAGAYDYGP PPRLSVATSA SHARRDFTAL HELGHHLQKN SFDLMEPFSR EPDGGVLLED       120
     AACDAFAAQI LLPAHLVDQH LDAKGPTASA ITLLWKTSNA SRMAVCVRAA QHLPAPGHVL       180
     LLDPDGHLAF AASNGLPPLP RGSFQGDIPV IDRALTGPGR AQGRTQVRYR DGILGRELHT       240
     DTAPMDGYTV AVLVTDSAPW RAFTPPTADT GPRSRDYICA NCDENYRSFE PACPRCHVPH       300
     CPECGSCACP PRTPGRSCPG CFLKHPPAMF APDSDRCLDC S                           341
//

If you have problems or comments...

PBIL Back to PBIL home page