(data stored in ACNUC7421 zone)

EMBL: AP009493.PE124

AP009493.PE124       Location/Qualifiers
FT   CDS             complement(129233..130174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_124t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_124t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16953"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND0"
FT                   /protein_id="BAG16953.1"
FT                   /translation="MDHSRGDGGDSMSSVHTTAYQRLVAAAAGLKVPDAVHQAATAPPQ
FT                   DPRPGQIWRAVWDDTIQLLLITTAGDQDTARAVPASFERYADADTLLLPAPATTLEQPL
FT                   ALWWGLETTLPWCVLDRPVSELTSRPDPLTSRMLADTVTGARWGSSTLVPAAAGEYRAA
FT                   LTDHLEVLASAQWAPQGSGGLSELLRDHAITVQQLAAELKLPPPLALDMWRGQQPLNAE
FT                   QADTLAALLGQPAARFLDTNPALPPAVVHELNRPLRRSQVKKLAAQYDETEHAARLRAA
FT                   YGVYTLAARDDNRTQPNWNARTDRYFELLLDE"
     MDHSRGDGGD SMSSVHTTAY QRLVAAAAGL KVPDAVHQAA TAPPQDPRPG QIWRAVWDDT        60
     IQLLLITTAG DQDTARAVPA SFERYADADT LLLPAPATTL EQPLALWWGL ETTLPWCVLD       120
     RPVSELTSRP DPLTSRMLAD TVTGARWGSS TLVPAAAGEY RAALTDHLEV LASAQWAPQG       180
     SGGLSELLRD HAITVQQLAA ELKLPPPLAL DMWRGQQPLN AEQADTLAAL LGQPAARFLD       240
     TNPALPPAVV HELNRPLRRS QVKKLAAQYD ETEHAARLRA AYGVYTLAAR DDNRTQPNWN       300
     ARTDRYFELL LDE                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page