(data stored in ACNUC7421 zone)

EMBL: AP009493.PE125

AP009493.PE125       Location/Qualifiers
FT   CDS             complement(130222..131181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_125t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_125t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16954"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND1"
FT                   /protein_id="BAG16954.1"
FT                   /translation="MGHVTQSAYEELQTGGLGPATFELLRRLVHQVRRGTGFPPPEGHT
FT                   AWSDDAAYDVISAMLSREGAGQRFVTACFTQAADEASLERLFLTSIKNFLIDEAKKTPR
FT                   GKLRRRIARLMGEDAAYRKLKGSPPRWALADHVEGAVWQGDLDDLIAQAAQVKGVGITR
FT                   WNHAGPTPRQTVHALKTVLLSVLRYAQGAVREEDLAKVLEARFDLLEPARFTALYADEG
FT                   TVAETVEQHAAAAAPDPTGVEGVAEDIWQRLTPNDRLLLPCIDEDAHHAAQLLEIRQGH
FT                   AAAVLSNLKTMLRNALSADIDPHAVMAALLRRCSETAS"
     MGHVTQSAYE ELQTGGLGPA TFELLRRLVH QVRRGTGFPP PEGHTAWSDD AAYDVISAML        60
     SREGAGQRFV TACFTQAADE ASLERLFLTS IKNFLIDEAK KTPRGKLRRR IARLMGEDAA       120
     YRKLKGSPPR WALADHVEGA VWQGDLDDLI AQAAQVKGVG ITRWNHAGPT PRQTVHALKT       180
     VLLSVLRYAQ GAVREEDLAK VLEARFDLLE PARFTALYAD EGTVAETVEQ HAAAAAPDPT       240
     GVEGVAEDIW QRLTPNDRLL LPCIDEDAHH AAQLLEIRQG HAAAVLSNLK TMLRNALSAD       300
     IDPHAVMAAL LRRCSETAS                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page