(data stored in ACNUC7421 zone)

EMBL: AP009493.PE126

AP009493.PE126       Location/Qualifiers
FT   CDS             complement(131394..132551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_126t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_126t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16955"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND2"
FT                   /protein_id="BAG16955.1"
FT                   /translation="MVRRSLTDAEARWVLEVVQSGRMTQTEAAAALGGTLSRINQLVNG
FT                   RTYKHLHGTAGVRVTDGGERYGITETPERRKFREASFWDRVDHSAGVNACWPFKGVKGN
FT                   KYGHTAAGQAMTGSASAHVVAFTLASGLQQALPGSTLLRHLCDFKPCCNPAHLLPGTKS
FT                   ENNRDTWVARREGRTGAKKVAEPVTPPQGGWSISTGDLVELDREARVSEFWARIDRRGG
FT                   DDACWPWTAKTRNHFGYGQLRWEGVQAALTHRIAYALSQGVTYKELGPAVIRHTCPEST
FT                   YRNNCNNPRHLRAGSQAENIADKAFHGTNARGERHPMGRRFPDALIREMRIRFWSVPPE
FT                   RRPTITALAKEAGTSVTVMSRWLRGEQRNDAGGPIAAMPGDFPRG"
     MVRRSLTDAE ARWVLEVVQS GRMTQTEAAA ALGGTLSRIN QLVNGRTYKH LHGTAGVRVT        60
     DGGERYGITE TPERRKFREA SFWDRVDHSA GVNACWPFKG VKGNKYGHTA AGQAMTGSAS       120
     AHVVAFTLAS GLQQALPGST LLRHLCDFKP CCNPAHLLPG TKSENNRDTW VARREGRTGA       180
     KKVAEPVTPP QGGWSISTGD LVELDREARV SEFWARIDRR GGDDACWPWT AKTRNHFGYG       240
     QLRWEGVQAA LTHRIAYALS QGVTYKELGP AVIRHTCPES TYRNNCNNPR HLRAGSQAEN       300
     IADKAFHGTN ARGERHPMGR RFPDALIREM RIRFWSVPPE RRPTITALAK EAGTSVTVMS       360
     RWLRGEQRND AGGPIAAMPG DFPRG                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page