(data stored in ACNUC7421 zone)

EMBL: AP009493.PE128

AP009493.PE128       Location/Qualifiers
FT   CDS             complement(133498..135453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_128"
FT                   /product="hypothetical protein with SsgA-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_128"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16957"
FT                   /db_xref="GOA:B1VND4"
FT                   /db_xref="InterPro:IPR006776"
FT                   /db_xref="InterPro:IPR038658"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND4"
FT                   /protein_id="BAG16957.1"
FT                   /translation="MSLHQDNAMPTAADDDEFTALMAASSLRAPHVRALSDPIPDEAQT
FT                   RLRESAEGPDAEQEPTARTTQEATTTDAGDASEDDPLDPCRLGNWPLRTFSWTMNSVLG
FT                   TPEHHAPALHLRALLAAGPPATTRTTGIHEWLLREPDNNRHYLLMHTEDPLTPTLLPCT
FT                   TDPGPTYSSASAFLRMALFRRRLEHVLGARPGTGFPDYRLTSTSAGPSAESLARTSFDI
FT                   ELNTTCNMYTALRLAGEPESRGSFTSRIRIHALMKQAYESALIDYAAHELAGNSQRSDQ
FT                   QVRAPGTADPTRFGAPAPAHSIDRLAAGRLTDLLQPARPPHIEQLHQHPADGRTRCRIA
FT                   TIPDRVPAGAWRPLLLSALSGYPWAHGTTPGGHLITGETALPGLTPQDTTAVTNRPLTP
FT                   AHLLIATDSAVSLDQAHRHTIPEQAPTPPDLDAYTAQPGSLLLLPAATATAAGHGDSRK
FT                   TVNRTHDTEDPDKELTSQNSSSDPSELLTDDRRTTKLWTTRTDDAGDGLEQRMQLWMRQ
FT                   HHTEDDRGDRILTQLAYRTKDPYAVTAVFYAGTEEELEWTFARELLTDGLHTSVGIGDV
FT                   IIWPGPQRPGDTQRIFIRLRPPGSTALLSLDHDDALEFLETTQPLPQNPSATARTAVLA
FT                   TWEQELRDLICPSPGE"
     MSLHQDNAMP TAADDDEFTA LMAASSLRAP HVRALSDPIP DEAQTRLRES AEGPDAEQEP        60
     TARTTQEATT TDAGDASEDD PLDPCRLGNW PLRTFSWTMN SVLGTPEHHA PALHLRALLA       120
     AGPPATTRTT GIHEWLLREP DNNRHYLLMH TEDPLTPTLL PCTTDPGPTY SSASAFLRMA       180
     LFRRRLEHVL GARPGTGFPD YRLTSTSAGP SAESLARTSF DIELNTTCNM YTALRLAGEP       240
     ESRGSFTSRI RIHALMKQAY ESALIDYAAH ELAGNSQRSD QQVRAPGTAD PTRFGAPAPA       300
     HSIDRLAAGR LTDLLQPARP PHIEQLHQHP ADGRTRCRIA TIPDRVPAGA WRPLLLSALS       360
     GYPWAHGTTP GGHLITGETA LPGLTPQDTT AVTNRPLTPA HLLIATDSAV SLDQAHRHTI       420
     PEQAPTPPDL DAYTAQPGSL LLLPAATATA AGHGDSRKTV NRTHDTEDPD KELTSQNSSS       480
     DPSELLTDDR RTTKLWTTRT DDAGDGLEQR MQLWMRQHHT EDDRGDRILT QLAYRTKDPY       540
     AVTAVFYAGT EEELEWTFAR ELLTDGLHTS VGIGDVIIWP GPQRPGDTQR IFIRLRPPGS       600
     TALLSLDHDD ALEFLETTQP LPQNPSATAR TAVLATWEQE LRDLICPSPG E                651
//

If you have problems or comments...

PBIL Back to PBIL home page