(data stored in ACNUC7421 zone)

EMBL: AP009493.PE129

AP009493.PE129       Location/Qualifiers
FT   CDS             complement(135450..136307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_129"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16958"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND5"
FT                   /protein_id="BAG16958.1"
FT                   /translation="MQDGDVKGHTPHDQVHHLDAETHTDPAAELRGLERSLTASTDPDA
FT                   AAHTRLREADASLVAFLRRRNFEGPHYRTFTAELMDYGWRTLSTWTASGHIFERTARMG
FT                   RPVPPAMMPDSWTYEDRTQVVTDTVIKGSSLFREHGLVRGKWTPDGGASLTTYFVGATI
FT                   LAFRPVYIRWHKNHHVGQSELNHRTADTDDILYAQQDIPDQRATDPAQAAVTHDDITRL
FT                   RTLLPDEQLREALGWMALGYTQAEAADRVGLTPKALERRLARARNRISASGLHTVQLEE
FT                   GGAR"
     MQDGDVKGHT PHDQVHHLDA ETHTDPAAEL RGLERSLTAS TDPDAAAHTR LREADASLVA        60
     FLRRRNFEGP HYRTFTAELM DYGWRTLSTW TASGHIFERT ARMGRPVPPA MMPDSWTYED       120
     RTQVVTDTVI KGSSLFREHG LVRGKWTPDG GASLTTYFVG ATILAFRPVY IRWHKNHHVG       180
     QSELNHRTAD TDDILYAQQD IPDQRATDPA QAAVTHDDIT RLRTLLPDEQ LREALGWMAL       240
     GYTQAEAADR VGLTPKALER RLARARNRIS ASGLHTVQLE EGGAR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page