(data stored in ACNUC7421 zone)

EMBL: AP009493.PE13

AP009493.PE13        Location/Qualifiers
FT   CDS             21132..21512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_13t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_13t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16842"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL1"
FT                   /protein_id="BAG16842.1"
FT                   /translation="MATVRAALDATLGIPHQAREVRLHRFSNADGPYWAADPEFHPDGT
FT                   CTALKPGAQRIASTDNATVQNVAWRNPDGSRALIAQTAAAPPSPSESTGAASPSPTPSR
FT                   HAPPPPSPGPARPAAHHRRSGR"
     MATVRAALDA TLGIPHQARE VRLHRFSNAD GPYWAADPEF HPDGTCTALK PGAQRIASTD        60
     NATVQNVAWR NPDGSRALIA QTAAAPPSPS ESTGAASPSP TPSRHAPPPP SPGPARPAAH       120
     HRRSGR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page