(data stored in ACNUC7421 zone)

EMBL: AP009493.PE130

AP009493.PE130       Location/Qualifiers
FT   CDS             136504..136860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16959"
FT                   /db_xref="GOA:B1VND6"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND6"
FT                   /protein_id="BAG16959.1"
FT                   /translation="MYTPPGPGPVGGTGGDAGRGAGQEPSVRDAAPGCSPGQVAQAAPG
FT                   RQDPASRDLPQGPQGEGPLLGLRSAIILMLGILVATAAGVLTYSAQQDPATAALAAGGA
FT                   FAGGVLFFQKIIAG"
     MYTPPGPGPV GGTGGDAGRG AGQEPSVRDA APGCSPGQVA QAAPGRQDPA SRDLPQGPQG        60
     EGPLLGLRSA IILMLGILVA TAAGVLTYSA QQDPATAALA AGGAFAGGVL FFQKIIAG         118
//

If you have problems or comments...

PBIL Back to PBIL home page