(data stored in ACNUC7421 zone)

EMBL: AP009493.PE131

AP009493.PE131       Location/Qualifiers
FT   CDS             137370..139826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_131"
FT                   /product="putative molecular chaperone with protein kinase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_131"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16960"
FT                   /db_xref="GOA:B1VND7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND7"
FT                   /protein_id="BAG16960.1"
FT                   /translation="MEPLRAGDPESVGGFVLRGRLGAGGMGEVFLGRSPGGRAVAVKVV
FT                   HPHLARQEEFRQRFAREVAAARAVSGAFTAPVMAAGPEDDRPWIATVYVPGPDLATAVG
FT                   VAGPLPEGAVWRLAAGLVEALQAIHVVGVVHRDLKPSNVLVAADGPRVIDFGIARTLED
FT                   TPLTMTGLVVGTAGFMAPEQAEGGKVGSACDVFALGAVIAFAATGAGPFGEGPQLAVLR
FT                   RVVGGRPRLDGLTGPLRELVEACLAKDPRDRPALATLLERIGAHWEPADEFRGGSPWPE
FT                   AVTTLIQRHATPPTAPYTEAAGATAPPDGGPNAARRARRAVGIDFGTTNSAVAVMEGGE
FT                   VLLIPNAQGRHTTPSLVALTAEGDALVGTDAERQALANPGFTAGAAMLWLGTDWRVARG
FT                   GVRLTAEDVAGLVLARLREDAEAYLGEPVTDAVLAVPAGFRRDQRAALVAAGERAGLNV
FT                   LRLVNVPTAVATSYGPNRDDLTVLVFDLGGGTLDVSLIELGDGVVEIRATAGDSRLGGN
FT                   DWDQRIVEHLTDHVRRRHGVDLTGDVAAIQRLREAAETARIELSAARTTTVRLPYLATG
FT                   PDSPVHLEEELTREELERLTQDLLERCRTPVENVLADAGCTLADIDQVVLTGGAALMPA
FT                   VGDLVRRLTGGQGSYQRLSPEAVVHGAVLQAGILTGEVKDVLLLDVAPYSIGVETHDGT
FT                   MKKLLQRNTTIPTRRSDVFTTHTDDQPMVLFHIVEGERKDAARNWPLAVLELALPPAPR
FT                   GVPMIEVTVDCTASDDLHIKVRDLGTGNETSATVGQATKERAAALLRSSRWARLRDLVP
FT                   VTHPAC"
     MEPLRAGDPE SVGGFVLRGR LGAGGMGEVF LGRSPGGRAV AVKVVHPHLA RQEEFRQRFA        60
     REVAAARAVS GAFTAPVMAA GPEDDRPWIA TVYVPGPDLA TAVGVAGPLP EGAVWRLAAG       120
     LVEALQAIHV VGVVHRDLKP SNVLVAADGP RVIDFGIART LEDTPLTMTG LVVGTAGFMA       180
     PEQAEGGKVG SACDVFALGA VIAFAATGAG PFGEGPQLAV LRRVVGGRPR LDGLTGPLRE       240
     LVEACLAKDP RDRPALATLL ERIGAHWEPA DEFRGGSPWP EAVTTLIQRH ATPPTAPYTE       300
     AAGATAPPDG GPNAARRARR AVGIDFGTTN SAVAVMEGGE VLLIPNAQGR HTTPSLVALT       360
     AEGDALVGTD AERQALANPG FTAGAAMLWL GTDWRVARGG VRLTAEDVAG LVLARLREDA       420
     EAYLGEPVTD AVLAVPAGFR RDQRAALVAA GERAGLNVLR LVNVPTAVAT SYGPNRDDLT       480
     VLVFDLGGGT LDVSLIELGD GVVEIRATAG DSRLGGNDWD QRIVEHLTDH VRRRHGVDLT       540
     GDVAAIQRLR EAAETARIEL SAARTTTVRL PYLATGPDSP VHLEEELTRE ELERLTQDLL       600
     ERCRTPVENV LADAGCTLAD IDQVVLTGGA ALMPAVGDLV RRLTGGQGSY QRLSPEAVVH       660
     GAVLQAGILT GEVKDVLLLD VAPYSIGVET HDGTMKKLLQ RNTTIPTRRS DVFTTHTDDQ       720
     PMVLFHIVEG ERKDAARNWP LAVLELALPP APRGVPMIEV TVDCTASDDL HIKVRDLGTG       780
     NETSATVGQA TKERAAALLR SSRWARLRDL VPVTHPAC                               818
//

If you have problems or comments...

PBIL Back to PBIL home page