(data stored in ACNUC7421 zone)

EMBL: AP009493.PE132

AP009493.PE132       Location/Qualifiers
FT   CDS             complement(140037..140435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_132"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16961"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND8"
FT                   /protein_id="BAG16961.1"
FT                   /translation="MTWGTNPGVINRELSKRLAAGRDRRLTQLADAATRWGGHVPEDPG
FT                   ITELADLLETAAADVPAPPGDPGHTARPGAPGHPARTLLAGAVENLRAAARLGGHLPAV
FT                   TLWHLQRAIDQEHTAHQQTVPAQRQGRT"
     MTWGTNPGVI NRELSKRLAA GRDRRLTQLA DAATRWGGHV PEDPGITELA DLLETAAADV        60
     PAPPGDPGHT ARPGAPGHPA RTLLAGAVEN LRAAARLGGH LPAVTLWHLQ RAIDQEHTAH       120
     QQTVPAQRQG RT                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page