(data stored in ACNUC7421 zone)

EMBL: AP009493.PE133

AP009493.PE133       Location/Qualifiers
FT   CDS             complement(140500..141678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_133"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16962"
FT                   /db_xref="UniProtKB/TrEMBL:B1VND9"
FT                   /protein_id="BAG16962.1"
FT                   /translation="MSVRLILTIADAVRRASQKHHHGQEHDLPDDIGQMAQSWWSADEL
FT                   GKHLPGSLLDHLTNTPDWPVTARQLVSLSRAGVDLTQFLPNLATMAAGVERAVARNTAR
FT                   TKTEGTDRWADLLRTTLPDGLVRNAILASPTWPDIAATMGRLHDQGIDVTRILTDAHTA
FT                   GLRIDQTIATAITPTTAPAPAAPAAPAAPAPAPAAPTAAPAPAAAVPLAPEVSADARNL
FT                   WGPLTEGLDIPHDLDLSDRARALEQLGITPAAHRTLVSQVNEALPQRDAALLVSSRQWP
FT                   ALAHRMTQQNGPLAAHLARIAPDTASWRTGPPSGITTRLLLAAHHALTTPLDQPLPTGP
FT                   RVSTTAARSRSTTVPDTATPKQPAPAGPAPTEPAAPAHRRTTAPAPRQGRGR"
     MSVRLILTIA DAVRRASQKH HHGQEHDLPD DIGQMAQSWW SADELGKHLP GSLLDHLTNT        60
     PDWPVTARQL VSLSRAGVDL TQFLPNLATM AAGVERAVAR NTARTKTEGT DRWADLLRTT       120
     LPDGLVRNAI LASPTWPDIA ATMGRLHDQG IDVTRILTDA HTAGLRIDQT IATAITPTTA       180
     PAPAAPAAPA APAPAPAAPT AAPAPAAAVP LAPEVSADAR NLWGPLTEGL DIPHDLDLSD       240
     RARALEQLGI TPAAHRTLVS QVNEALPQRD AALLVSSRQW PALAHRMTQQ NGPLAAHLAR       300
     IAPDTASWRT GPPSGITTRL LLAAHHALTT PLDQPLPTGP RVSTTAARSR STTVPDTATP       360
     KQPAPAGPAP TEPAAPAHRR TTAPAPRQGR GR                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page