(data stored in ACNUC7421 zone)

EMBL: AP009493.PE134

AP009493.PE134       Location/Qualifiers
FT   CDS             141857..142792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_134"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16963"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE0"
FT                   /protein_id="BAG16963.1"
FT                   /translation="MRSGGGSGRYCGNGRGCGGATGRGGCHPYGARRCCGAGGGAGQVG
FT                   GFAQEGGGLGGGCCLSAVLVERPAAQRGGGAGQVGGFAQEGGGLGPLSGRPPVDRAGRC
FT                   PVFVKVASVPLIMANRLGRWALRLGVRVVGTVMAMREGSRLCVMCGTGLLGGTAYLVDG
FT                   ARRQGRRTPTRFLICGSCYDRGCPDPETGLTRAVSTRQTQSIEWRELAGRGPALPPQAC
FT                   VAGCGLVVVRGAEKTMRGVTCSRACRTSITRKRHGGIGSSRPCGACGTPVTAGRADSEY
FT                   CNAACRQKAYRSRRARRLLSNPVPDQNLHA"
     MRSGGGSGRY CGNGRGCGGA TGRGGCHPYG ARRCCGAGGG AGQVGGFAQE GGGLGGGCCL        60
     SAVLVERPAA QRGGGAGQVG GFAQEGGGLG PLSGRPPVDR AGRCPVFVKV ASVPLIMANR       120
     LGRWALRLGV RVVGTVMAMR EGSRLCVMCG TGLLGGTAYL VDGARRQGRR TPTRFLICGS       180
     CYDRGCPDPE TGLTRAVSTR QTQSIEWREL AGRGPALPPQ ACVAGCGLVV VRGAEKTMRG       240
     VTCSRACRTS ITRKRHGGIG SSRPCGACGT PVTAGRADSE YCNAACRQKA YRSRRARRLL       300
     SNPVPDQNLH A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page