(data stored in ACNUC7421 zone)

EMBL: AP009493.PE135

AP009493.PE135       Location/Qualifiers
FT   CDS             143100..143963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_135"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16964"
FT                   /db_xref="GOA:B1VNE1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE1"
FT                   /protein_id="BAG16964.1"
FT                   /translation="MAGSRRAARVGSAVSGGSAGIAFLVGIVTNYVTAELPGWAENTVV
FT                   VWSVFGALVVVSLGLFFWERRLAAVAPDGGGRAVPLGRIAAGGHSMDPPAVSARVRGRE
FT                   AELERLGGLVRGDGGGMVVVCGVGGLGKTTLAAEAAARARAEGRVVVWVRWRDDPAQLG
FT                   QDFARAAHVLGLAEARLEEARTGRVSLVDAVWEHLAAVEGWVIVVDNVDTPGRVGPGSE
FT                   PPAAYRGWLRPYGAGCCWSRAGTRARRPGGRMPACCTFSPSPATRAELFFWMPHPVPGP
FT                   RPRQKR"
     MAGSRRAARV GSAVSGGSAG IAFLVGIVTN YVTAELPGWA ENTVVVWSVF GALVVVSLGL        60
     FFWERRLAAV APDGGGRAVP LGRIAAGGHS MDPPAVSARV RGREAELERL GGLVRGDGGG       120
     MVVVCGVGGL GKTTLAAEAA ARARAEGRVV VWVRWRDDPA QLGQDFARAA HVLGLAEARL       180
     EEARTGRVSL VDAVWEHLAA VEGWVIVVDN VDTPGRVGPG SEPPAAYRGW LRPYGAGCCW       240
     SRAGTRARRP GGRMPACCTF SPSPATRAEL FFWMPHPVPG PRPRQKR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page