(data stored in ACNUC7421 zone)

EMBL: AP009493.PE136

AP009493.PE136       Location/Qualifiers
FT   CDS             complement(144052..144360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_136"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16965"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE2"
FT                   /protein_id="BAG16965.1"
FT                   /translation="MSKSGRDRAKLLEACEASFDHVAFAVGLLVEGAGPAAEVPSAAGG
FT                   WSRCSGIVTAMPRCRSRRPGPQPPEHPVDHLSVIKPRTTTPRTTTPIHPRQHSLPRR"
     MSKSGRDRAK LLEACEASFD HVAFAVGLLV EGAGPAAEVP SAAGGWSRCS GIVTAMPRCR        60
     SRRPGPQPPE HPVDHLSVIK PRTTTPRTTT PIHPRQHSLP RR                          102
//

If you have problems or comments...

PBIL Back to PBIL home page