(data stored in ACNUC7421 zone)

EMBL: AP009493.PE137

AP009493.PE137       Location/Qualifiers
FT   CDS             complement(144434..144931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_137"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16966"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE3"
FT                   /protein_id="BAG16966.1"
FT                   /translation="MAVLNVHERLVAAGADAVGELLDTLSAGPEDRLWPSAHWPAMRLD
FT                   RGLSPGSAGGHGPIRYAVNAYEPGARVRFDFTGPPGFHGFHEFAVVPVDAHRTLLRHTL
FT                   SMRTTGAARLAWPLLYRPLHDALVEDALDRAEPTARPARWSPYVRLLRTALARRGWSPS
FT                   DK"
     MAVLNVHERL VAAGADAVGE LLDTLSAGPE DRLWPSAHWP AMRLDRGLSP GSAGGHGPIR        60
     YAVNAYEPGA RVRFDFTGPP GFHGFHEFAV VPVDAHRTLL RHTLSMRTTG AARLAWPLLY       120
     RPLHDALVED ALDRAEPTAR PARWSPYVRL LRTALARRGW SPSDK                       165
//

If you have problems or comments...

PBIL Back to PBIL home page