(data stored in ACNUC7421 zone)

EMBL: AP009493.PE139

AP009493.PE139       Location/Qualifiers
FT   CDS             146885..147574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_139"
FT                   /product="putative gamma-butyrolactone-binding protein
FT                   homologue"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_139"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16968"
FT                   /db_xref="GOA:B1VNE5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE5"
FT                   /protein_id="BAG16968.1"
FT                   /translation="MRRLVQQRSMHKRQELVAAAARVFAEKGYYRTTVEDITTLAGVGR
FT                   GAFYHYFNKGKSDVATAVVTEGFTMDAAVPMLPRIQSVVDASIALATLTPVVPVVKAAA
FT                   RLATEQDHPDFYGHLIRLYIPQVTQLIEQAAELGELQQGVDPALTAEAWVMLYSGTDQH
FT                   ARLDYRRLPQKIAQANTVIVRGIVTAETALKLDMSVQRGDLLVRQSRWAEEYIQGLDAA
FT                   ASAGSPA"
     MRRLVQQRSM HKRQELVAAA ARVFAEKGYY RTTVEDITTL AGVGRGAFYH YFNKGKSDVA        60
     TAVVTEGFTM DAAVPMLPRI QSVVDASIAL ATLTPVVPVV KAAARLATEQ DHPDFYGHLI       120
     RLYIPQVTQL IEQAAELGEL QQGVDPALTA EAWVMLYSGT DQHARLDYRR LPQKIAQANT       180
     VIVRGIVTAE TALKLDMSVQ RGDLLVRQSR WAEEYIQGLD AAASAGSPA                   229
//

If you have problems or comments...

PBIL Back to PBIL home page