(data stored in ACNUC7421 zone)

EMBL: AP009493.PE14

AP009493.PE14        Location/Qualifiers
FT   CDS             21539..21733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_14t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_14t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16843"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL2"
FT                   /protein_id="BAG16843.1"
FT                   /translation="MADGSSADGTAAQLHTCNSTVAQRRSYSATTHDVVNTAADKCLDV
FT                   TGNNSADGIWSCTGAANQK"
     MADGSSADGT AAQLHTCNST VAQRRSYSAT THDVVNTAAD KCLDVTGNNS ADGIWSCTGA        60
     ANQK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page