(data stored in ACNUC7421 zone)

EMBL: AP009493.PE140

AP009493.PE140       Location/Qualifiers
FT   CDS             148019..148822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16969"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE6"
FT                   /protein_id="BAG16969.1"
FT                   /translation="MRSRRAEWRGRAVPGAGREYQRLMERYRRRRTRKEIGLGPLPSGR
FT                   GRRGSDRIRQVDVDTALQGGAGTYQKICTGRLRPSPDLYMRLAQLLGFSREDTVLGHLE
FT                   LFRTEPVLPPVPPSPLLGRLIGGQGEIACAITPDGRRVAANSAFAALFPGGGPPANLWR
FT                   WALFSPDAERVLLDWEQAWAPRLLTEIKVMCRRAQRDGAALRLLSEVEGDARLRAVEET
FT                   GSGLGGAPLPLRHPALGDGTVHLLTARTAGASILTFIFEPGDQEL"
     MRSRRAEWRG RAVPGAGREY QRLMERYRRR RTRKEIGLGP LPSGRGRRGS DRIRQVDVDT        60
     ALQGGAGTYQ KICTGRLRPS PDLYMRLAQL LGFSREDTVL GHLELFRTEP VLPPVPPSPL       120
     LGRLIGGQGE IACAITPDGR RVAANSAFAA LFPGGGPPAN LWRWALFSPD AERVLLDWEQ       180
     AWAPRLLTEI KVMCRRAQRD GAALRLLSEV EGDARLRAVE ETGSGLGGAP LPLRHPALGD       240
     GTVHLLTART AGASILTFIF EPGDQEL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page