(data stored in ACNUC7421 zone)

EMBL: AP009493.PE141

AP009493.PE141       Location/Qualifiers
FT   CDS             148819..149457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_141"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16970"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE7"
FT                   /protein_id="BAG16970.1"
FT                   /translation="MMHILVPEDPVFMTRFLDVEEPLLHSLYYLHRGHMPRDQAKTVAR
FT                   AYEAWGDIQAAMPKFLSWHTPTAFELAVPRRESEGHRLHSPDGRQLISLYAVDVGVESI
FT                   SGLAACLTLLEEAEKDLGGALAGALEEIREPRERDLVDNFRRVLQALRIPAPPALLASL
FT                   RDAAPAGPVQEVTLDCGQHAEYTAFGDRFCRAVSSGDLFMYTMHRSLYP"
     MMHILVPEDP VFMTRFLDVE EPLLHSLYYL HRGHMPRDQA KTVARAYEAW GDIQAAMPKF        60
     LSWHTPTAFE LAVPRRESEG HRLHSPDGRQ LISLYAVDVG VESISGLAAC LTLLEEAEKD       120
     LGGALAGALE EIREPRERDL VDNFRRVLQA LRIPAPPALL ASLRDAAPAG PVQEVTLDCG       180
     QHAEYTAFGD RFCRAVSSGD LFMYTMHRSL YP                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page