(data stored in ACNUC7421 zone)

EMBL: AP009493.PE143

AP009493.PE143       Location/Qualifiers
FT   CDS             complement(151473..151814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_143"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16972"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNE9"
FT                   /protein_id="BAG16972.1"
FT                   /translation="MRSRRPARRSRGDPRAARLAHPVRRAVYPVGRLSLSGRRTRVRRE
FT                   RQGDRLRGAGEGSRSSGALADVPCAVPSLRSSRPSCWSRGAVFPGRCRFLPRCGGAPSS
FT                   FPITGSGGR"
     MRSRRPARRS RGDPRAARLA HPVRRAVYPV GRLSLSGRRT RVRRERQGDR LRGAGEGSRS        60
     SGALADVPCA VPSLRSSRPS CWSRGAVFPG RCRFLPRCGG APSSFPITGS GGR              113
//

If you have problems or comments...

PBIL Back to PBIL home page