(data stored in ACNUC7421 zone)

EMBL: AP009493.PE148

AP009493.PE148       Location/Qualifiers
FT   CDS             complement(155606..156637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_148"
FT                   /product="putative ABC transporter solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_148"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16977"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF4"
FT                   /protein_id="BAG16977.1"
FT                   /translation="MAPRTLLRSLIAATAAAAALSLTACGAITSADGSSGSSGDGSFKL
FT                   APYIQQRIDDDKPMRIKLSYHDPSLAFATPISAGMKKAGKETGADVALIGPTGGDAAKQ
FT                   VSEIQTLIQQKAVDGLAVSSASSDALKPVISQAYKAGIPIISFNTDNPDSDQMGFVGQD
FT                   LKGSGKAQAEQLRKDLKGDLNGKSVVVFSVDTGAGWSHDRFSGFKEGLDGSGLKVVGPV
FT                   NVGNEPSSAYNTVESTMSGQSNVVAVAGLDCCSTTAAAKWVAQSGKADDITMGGFDLLT
FT                   QTAEYIERGVLDFSISQNPSEQGYQAVKVLHDYLSGGTEIKGVDTGAQFVTRDNLADTA
FT                   VED"
     MAPRTLLRSL IAATAAAAAL SLTACGAITS ADGSSGSSGD GSFKLAPYIQ QRIDDDKPMR        60
     IKLSYHDPSL AFATPISAGM KKAGKETGAD VALIGPTGGD AAKQVSEIQT LIQQKAVDGL       120
     AVSSASSDAL KPVISQAYKA GIPIISFNTD NPDSDQMGFV GQDLKGSGKA QAEQLRKDLK       180
     GDLNGKSVVV FSVDTGAGWS HDRFSGFKEG LDGSGLKVVG PVNVGNEPSS AYNTVESTMS       240
     GQSNVVAVAG LDCCSTTAAA KWVAQSGKAD DITMGGFDLL TQTAEYIERG VLDFSISQNP       300
     SEQGYQAVKV LHDYLSGGTE IKGVDTGAQF VTRDNLADTA VED                         343
//

If you have problems or comments...

PBIL Back to PBIL home page