(data stored in ACNUC7421 zone)

EMBL: AP009493.PE149

AP009493.PE149       Location/Qualifiers
FT   CDS             complement(156816..157853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_149"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_149"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16978"
FT                   /db_xref="GOA:B1VNF5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF5"
FT                   /protein_id="BAG16978.1"
FT                   /translation="MTSTTTKPPTTAAPPSDASTRQFPLALRRLLHAREAGVFAALVLI
FT                   FLLGTVLSPTFAQSDNLLAVGQQIAQIGIMAVGATFVILNGEIDLSVGSTYALSAISTG
FT                   MLISDGWSWPAAMLVGLAVGAVAGLLNGLAVVVLGVPSFIVTLGTLSVFRGIALLISDG
FT                   APISLSSSQPGVSEFNLLGQGRLFGIVPMQFVFFAAVAAIGVVLLARSRFGFNTYAVGG
FT                   NQEAARLVGVNVKRVKLTAFVLSGFCAGLAGVLGLSFLSYVQGVTGQGLELTVISAVII
FT                   GGAALFGGSGTMWGTVIGVAFIGLLQNILNIKGISSFWQTVVTGLVIVAAVAADTWQRK
FT                   RKTRA"
     MTSTTTKPPT TAAPPSDAST RQFPLALRRL LHAREAGVFA ALVLIFLLGT VLSPTFAQSD        60
     NLLAVGQQIA QIGIMAVGAT FVILNGEIDL SVGSTYALSA ISTGMLISDG WSWPAAMLVG       120
     LAVGAVAGLL NGLAVVVLGV PSFIVTLGTL SVFRGIALLI SDGAPISLSS SQPGVSEFNL       180
     LGQGRLFGIV PMQFVFFAAV AAIGVVLLAR SRFGFNTYAV GGNQEAARLV GVNVKRVKLT       240
     AFVLSGFCAG LAGVLGLSFL SYVQGVTGQG LELTVISAVI IGGAALFGGS GTMWGTVIGV       300
     AFIGLLQNIL NIKGISSFWQ TVVTGLVIVA AVAADTWQRK RKTRA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page