(data stored in ACNUC7421 zone)

EMBL: AP009493.PE152

AP009493.PE152       Location/Qualifiers
FT   CDS             complement(159896..162562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_152"
FT                   /product="putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_152"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16981"
FT                   /db_xref="GOA:B1VNF8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNF8"
FT                   /protein_id="BAG16981.1"
FT                   /translation="MRTVPSPGAVEPGGNQGIGQRIELLLAGCERRLVRDGQWLCLFAP
FT                   RPLGSEIPDHGWKLHISARPNDLSPLVDLVVPVLLRYLCDAKFARDAGVLGAMNSGDRD
FT                   PALVGKAITVYPRAEDVRALGGELADLLSGRPGPRVLSDRRIRPDAPVYYRYGPFRATG
FT                   ADDAALTMTGPDGVRFPGRAGTRYRQPPWAADPFRSAAPAPDRPARLIGGRYRLTAGIT
FT                   RSAHGDVYRAVDRATREHLIVKQARAHAGEDAHGVDARGRLRHEHAVLAALTGVDGVPQ
FT                   IREHLRHGDDEFLVTTDCGPRDLRRDVLAHGPFQPGAALSPAGSEPADAMATGRGIAEL
FT                   ARRLLAVLDSVHTRGVVVGDLKPSNVVLGDDGAAHLVDFGISALHGDRPTGATPGYSMP
FT                   AYRAGRPTGPADDLYALGATLYFALTGMDPVVVDSDDDVNRDRTLLCLAAVLPGAEHRP
FT                   VRELVAGLTHPDPAQRAAHGQRWRTQAPALAPERVIPLPRITPGILDDLIAHTVASCVS
FT                   AAAQLPTGAARDGQPGFGLTLYDGAAGVGLELLHHTEQPGVPRAVADLAHRTALHPQLG
FT                   ALSDALHIGRTGVDLFLDSATVLNDAPAPLPPHRGLSHDRTGDQISGAAGVGTGLLALA
FT                   RRARTAGREEEARARLAAAEECAHGLLAARAGRERAEPRSSAADSEAAFTLGFAHGRAG
FT                   VIHFLHAYHRFTGDPAAGAAARQDLAELISHTPRLLALAARPEAHRRYGSWCRGLAGIG
FT                   TLLIETGRYEGDMPATDLGVRCAWSCRDLAPRMSPVSQCCGLSGVGELLIDAAAVTGDD
FT                   RLFRAAEDVAGLILARSGGTMRKPLFPDNTLAASGPGWATGSAGVLSFLRRLRDRGGPR
FT                   LWTDSPARPVARTPRSR"
     MRTVPSPGAV EPGGNQGIGQ RIELLLAGCE RRLVRDGQWL CLFAPRPLGS EIPDHGWKLH        60
     ISARPNDLSP LVDLVVPVLL RYLCDAKFAR DAGVLGAMNS GDRDPALVGK AITVYPRAED       120
     VRALGGELAD LLSGRPGPRV LSDRRIRPDA PVYYRYGPFR ATGADDAALT MTGPDGVRFP       180
     GRAGTRYRQP PWAADPFRSA APAPDRPARL IGGRYRLTAG ITRSAHGDVY RAVDRATREH       240
     LIVKQARAHA GEDAHGVDAR GRLRHEHAVL AALTGVDGVP QIREHLRHGD DEFLVTTDCG       300
     PRDLRRDVLA HGPFQPGAAL SPAGSEPADA MATGRGIAEL ARRLLAVLDS VHTRGVVVGD       360
     LKPSNVVLGD DGAAHLVDFG ISALHGDRPT GATPGYSMPA YRAGRPTGPA DDLYALGATL       420
     YFALTGMDPV VVDSDDDVNR DRTLLCLAAV LPGAEHRPVR ELVAGLTHPD PAQRAAHGQR       480
     WRTQAPALAP ERVIPLPRIT PGILDDLIAH TVASCVSAAA QLPTGAARDG QPGFGLTLYD       540
     GAAGVGLELL HHTEQPGVPR AVADLAHRTA LHPQLGALSD ALHIGRTGVD LFLDSATVLN       600
     DAPAPLPPHR GLSHDRTGDQ ISGAAGVGTG LLALARRART AGREEEARAR LAAAEECAHG       660
     LLAARAGRER AEPRSSAADS EAAFTLGFAH GRAGVIHFLH AYHRFTGDPA AGAAARQDLA       720
     ELISHTPRLL ALAARPEAHR RYGSWCRGLA GIGTLLIETG RYEGDMPATD LGVRCAWSCR       780
     DLAPRMSPVS QCCGLSGVGE LLIDAAAVTG DDRLFRAAED VAGLILARSG GTMRKPLFPD       840
     NTLAASGPGW ATGSAGVLSF LRRLRDRGGP RLWTDSPARP VARTPRSR                    888
//

If you have problems or comments...

PBIL Back to PBIL home page