(data stored in ACNUC7421 zone)

EMBL: AP009493.PE155

AP009493.PE155       Location/Qualifiers
FT   CDS             164266..164985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_155"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16984"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG1"
FT                   /protein_id="BAG16984.1"
FT                   /translation="MTEGFNVAAELAGVSDRADAWRFIRGFVAHWRKPVRPGDGCDSGE
FT                   LTEAECRLGSQLPAALWEAYGLFGRRPDLTSVQDSLLSPEHLHVDDGALVFRLENQAVA
FT                   EWAIRQEHLTDDDPPVVFRRRDGDSDRWMPFLDRFSTACIEMVLSESLFAHSETRADNR
FT                   PLEESEDIGASPGFQRLALPDYPMWAVEGCVIRWFASPEGLLREDAGEWLWALGLTAPA
FT                   LDSLRGSVPGDWINQPS"
     MTEGFNVAAE LAGVSDRADA WRFIRGFVAH WRKPVRPGDG CDSGELTEAE CRLGSQLPAA        60
     LWEAYGLFGR RPDLTSVQDS LLSPEHLHVD DGALVFRLEN QAVAEWAIRQ EHLTDDDPPV       120
     VFRRRDGDSD RWMPFLDRFS TACIEMVLSE SLFAHSETRA DNRPLEESED IGASPGFQRL       180
     ALPDYPMWAV EGCVIRWFAS PEGLLREDAG EWLWALGLTA PALDSLRGSV PGDWINQPS        239
//

If you have problems or comments...

PBIL Back to PBIL home page