(data stored in ACNUC7421 zone)

EMBL: AP009493.PE156

AP009493.PE156       Location/Qualifiers
FT   CDS             165050..165343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_156"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16985"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG2"
FT                   /protein_id="BAG16985.1"
FT                   /translation="MNGEASCGARAGGVCPEAEALVKGAFGVARGRRSGAQKMLRFPLK
FT                   WRPGHSWRSEEMRDDGRGDHRCVRCPTRSHLSGLGLTFPLPASLVREWFRHV"
     MNGEASCGAR AGGVCPEAEA LVKGAFGVAR GRRSGAQKML RFPLKWRPGH SWRSEEMRDD        60
     GRGDHRCVRC PTRSHLSGLG LTFPLPASLV REWFRHV                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page