(data stored in ACNUC7421 zone)

EMBL: AP009493.PE157

AP009493.PE157       Location/Qualifiers
FT   CDS             165438..166493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_157"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16986"
FT                   /db_xref="GOA:B1VNG3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG3"
FT                   /protein_id="BAG16986.1"
FT                   /translation="MADYGWDAERERSFGPSRDEGLVPGRAVRAERGLCDVVAETGPVR
FT                   AMVLPSSGTGDRLTPCTGDWVSVRPAGPATSATVVEVLERRTAVVRSTSSRTSHAQVLA
FT                   SNVDTVAVAVSLADPLKLGRIERTLALAWESGATPVIVLTKADRSTDPASAASEVAEAA
FT                   PGVEVLVTSATTGEGLDILTAVLSGTVVLLGPSGAGKSTLGNRLLGEDLLATGEVRGSD
FT                   GKGRHTTAWRELVPLPHGGVLLDTPGLRGVGLHDADDGLEHTFAEITELARDCRFADCA
FT                   HTTEPGCAVLAAVEDGRLTQRRLDSYHRLQRENTYAAARTDARLRAELERPMKQISRQV
FT                   RALKQSPHFKA"
     MADYGWDAER ERSFGPSRDE GLVPGRAVRA ERGLCDVVAE TGPVRAMVLP SSGTGDRLTP        60
     CTGDWVSVRP AGPATSATVV EVLERRTAVV RSTSSRTSHA QVLASNVDTV AVAVSLADPL       120
     KLGRIERTLA LAWESGATPV IVLTKADRST DPASAASEVA EAAPGVEVLV TSATTGEGLD       180
     ILTAVLSGTV VLLGPSGAGK STLGNRLLGE DLLATGEVRG SDGKGRHTTA WRELVPLPHG       240
     GVLLDTPGLR GVGLHDADDG LEHTFAEITE LARDCRFADC AHTTEPGCAV LAAVEDGRLT       300
     QRRLDSYHRL QRENTYAAAR TDARLRAELE RPMKQISRQV RALKQSPHFK A                351
//

If you have problems or comments...

PBIL Back to PBIL home page