(data stored in ACNUC7421 zone)

EMBL: AP009493.PE158

AP009493.PE158       Location/Qualifiers
FT   CDS             166490..167257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_158"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16987"
FT                   /db_xref="InterPro:IPR017031"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG4"
FT                   /protein_id="BAG16987.1"
FT                   /translation="MTERNTVMDLPRIFTIRESNHRIHNPLTADKFAALGESLRLPAGT
FT                   RVLDLASGSGEMLCTWARDLGFTGSGVDISTIFTEQAQARAAELGVADRVDFLHGDAAG
FT                   HVTDQPVDLAACVGATWIGDGVAGTTELLQRSLRPGGMMLIGEPFWRQTPPDEETATAC
FT                   HATSIADFLLLPELIGQFRELGYDVVEMMLADQNSWDRYAAAQWLSMRRWLDENPDDEL
FT                   ASEVREELTTEPAHYARYGREYLSWGVFALMKR"
     MTERNTVMDL PRIFTIRESN HRIHNPLTAD KFAALGESLR LPAGTRVLDL ASGSGEMLCT        60
     WARDLGFTGS GVDISTIFTE QAQARAAELG VADRVDFLHG DAAGHVTDQP VDLAACVGAT       120
     WIGDGVAGTT ELLQRSLRPG GMMLIGEPFW RQTPPDEETA TACHATSIAD FLLLPELIGQ       180
     FRELGYDVVE MMLADQNSWD RYAAAQWLSM RRWLDENPDD ELASEVREEL TTEPAHYARY       240
     GREYLSWGVF ALMKR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page