(data stored in ACNUC7421 zone)

EMBL: AP009493.PE16

AP009493.PE16        Location/Qualifiers
FT   CDS             complement(23792..24679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_16t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_16t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16845"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKL4"
FT                   /protein_id="BAG16845.1"
FT                   /translation="MSPATFTAMCSANASSPRRWDGTPARSPRSRSLRVAPDSPTRLVR
FT                   SAQPGHCPDCGNRIDWHPRTDGDDRAVGLHPQELPAAAVPAVSRWHVSSGIAHPAHDGT
FT                   PWCRIPHTALCPARSAPAALTPQLAALRRHLALHTRRLINNDVLTTPAAPPSERTESCR
FT                   PARPVAHLLGVCYIAGHPIDVIQCVAQTRQRHRCTRPVLDDQAPHGTWTLFPTALPSNR
FT                   PLSLPTDRMAVYDLTHLAFAEQLRWRHQHCPGHAASSAADLARTEWEPFDPRLHHQHIH
FT                   QRLPHGARKQNHGA"
     MSPATFTAMC SANASSPRRW DGTPARSPRS RSLRVAPDSP TRLVRSAQPG HCPDCGNRID        60
     WHPRTDGDDR AVGLHPQELP AAAVPAVSRW HVSSGIAHPA HDGTPWCRIP HTALCPARSA       120
     PAALTPQLAA LRRHLALHTR RLINNDVLTT PAAPPSERTE SCRPARPVAH LLGVCYIAGH       180
     PIDVIQCVAQ TRQRHRCTRP VLDDQAPHGT WTLFPTALPS NRPLSLPTDR MAVYDLTHLA       240
     FAEQLRWRHQ HCPGHAASSA ADLARTEWEP FDPRLHHQHI HQRLPHGARK QNHGA            295
//

If you have problems or comments...

PBIL Back to PBIL home page