(data stored in ACNUC7421 zone)

EMBL: AP009493.PE160

AP009493.PE160       Location/Qualifiers
FT   CDS             167518..168480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_160"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16989"
FT                   /db_xref="GOA:B1VNG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNG6"
FT                   /protein_id="BAG16989.1"
FT                   /translation="MDNAATPSIRTIGLGRDFADHTAVHRLDLEVNAGEVYGLLGPNGS
FT                   GKSTTVRMLTTMLRPSRGTAQVAGADVARDPGTVRRRAGVVLQGTALDPLMSARELLRL
FT                   QGRLQSLTPRQARARCTELLTAFDARDFADTPVGRLSGGQRRRVDLAVALVQRPDVLFL
FT                   DEPTTGLDPASRRDLWDEIRTLAANHGVTVLLTTQHLEEADQLCDRVGILRAGRLIASA
FT                   APHALKDEVGDRFLTLRFRDASAADQARELLAAKGEQLHTAETAPHAVSIRLARPGADG
FT                   ETLLTLASAGLHAESLTVDEPSLEDVFLRLALTPEGAAA"
     MDNAATPSIR TIGLGRDFAD HTAVHRLDLE VNAGEVYGLL GPNGSGKSTT VRMLTTMLRP        60
     SRGTAQVAGA DVARDPGTVR RRAGVVLQGT ALDPLMSARE LLRLQGRLQS LTPRQARARC       120
     TELLTAFDAR DFADTPVGRL SGGQRRRVDL AVALVQRPDV LFLDEPTTGL DPASRRDLWD       180
     EIRTLAANHG VTVLLTTQHL EEADQLCDRV GILRAGRLIA SAAPHALKDE VGDRFLTLRF       240
     RDASAADQAR ELLAAKGEQL HTAETAPHAV SIRLARPGAD GETLLTLASA GLHAESLTVD       300
     EPSLEDVFLR LALTPEGAAA                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page